PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC16300_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 238aa    MW: 27650.9 Da    PI: 9.3893
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC16300_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.99.4e-20766357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 +R+++t+eql +Lee++++  r+p+a ++++++++l    +++ ++V++WFqN++a++++
  RrC16300_p1  7 TRWCPTPEQLMILEEMYRSgIRTPNAVQIQQITAHLafygRIEGKNVFYWFQNHKARDRQ 66
                 7*****************99*************************************996 PP

2Wus_type_Homeobox119.71.3e-38667364
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        tRW+PtpeQ++iLee+y+sG+rtPn+ +iq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqk
        RrC16300_p1  6 ATRWCPTPEQLMILEEMYRSGIRTPNAVQIQQITAHLAFYGRIEGKNVFYWFQNHKARDRQK 67
                       79***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0021471IPR001356Homeobox domain
CDDcd000861.23E-4767No hitNo description
SuperFamilySSF466896.84E-11767IPR009057Homeodomain-like
PfamPF000461.8E-17766IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.6E-7866IPR009057Homeodomain-like
PROSITE profilePS500719.7661267IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MSPVAATRWC PTPEQLMILE EMYRSGIRTP NAVQIQQITA HLAFYGRIEG KNVFYWFQNH  60
KARDRQKLRK KLAKQLHQQQ HHLQLQLQQI QPKSMSMMPQ PLSNIIDHHN HYQHHHNHHR  120
SYDHMSFGCC SQVCNILNCL AHQGIGVEAQ SKVLSEHYCN KSGHEDMLMQ RPITGQNTSY  180
GRDWMMMMDM GPRPSYPSSS VPVPYCNMMM MNSPKIPLKT LELFPISSIN SKQDSSKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894329e-83AC189432.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB068E07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013744202.11e-120PREDICTED: WUSCHEL-related homeobox 3-like
SwissprotQ9SIB41e-105WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBLA0A078CJ271e-120A0A078CJ27_BRANA; BnaC04g39860D protein
STRINGBra000484.1-P1e-114(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74802642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.12e-96WOX family protein